PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01573.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 327aa    MW: 36748.2 Da    PI: 8.5582
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01573.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.43.2e-081255344
                             SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
          Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                             +W+ ++d  + +a   +  +   +W++Ia  ++ g+tl+q++ ++
  Rsa1.0_01573.1_g00005.1 12 SWSRDDDIAFEKALSIYTDEtenRWEKIAGVLP-GKTLEQVIKHY 55
                             7*****************99*************.**********9 PP

2Myb_DNA-binding44.82.9e-14117161347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +WT++E+ +++ + +++G+g+W++I+r + ++Rt+ q+ s+ qky
  Rsa1.0_01573.1_g00005.1 117 AWTPDEHSKFLIGLEKYGKGDWRSISRNLVLTRTPTQVASHAQKY 161
                              6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.53862IPR017884SANT domain
SMARTSM007176.5E-9961IPR001005SANT/Myb domain
SuperFamilySSF466895.76E-111167IPR009057Homeodomain-like
CDDcd001672.06E-81259No hitNo description
PfamPF002496.0E-61255IPR001005SANT/Myb domain
PROSITE profilePS5129418.106109166IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-10109163IPR009057Homeodomain-like
SuperFamilySSF466897.25E-16111166IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-15114164IPR006447Myb domain, plants
SMARTSM007171.9E-9114164IPR001005SANT/Myb domain
CDDcd001671.86E-9117162No hitNo description
PfamPF002492.0E-11117161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MSIGEKTNGS SSWSRDDDIA FEKALSIYTD ETENRWEKIA GVLPGKTLEQ VIKHYEILLR  60
DVMMIESGCV SLPEYDSSEG THAKDTNISK SCIINRKCEY TQDCIPILKQ KRRKGIAWTP  120
DEHSKFLIGL EKYGKGDWRS ISRNLVLTRT PTQVASHAQK YFARLNSKNK NKMRQRILDV  180
DAGESNNTST MQRPNTSQNA RAIQATSQDH HPTYNTPTIW NTQTTLQQPL ERPMYGTPTT  240
WNIQAASQPS VDIPIYDTHI VDQSLVGHML SPFGSNMNRL APSHVAYGVQ HHSAPYSSFS  300
SAPYSSVLSA PFNMAASYNM TYAPTSH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-14785483RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009150894.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_009150895.10.0PREDICTED: transcription factor DIVARICATA
TrEMBLM4CZQ20.0M4CZQ2_BRARP; Uncharacterized protein
STRINGBra009699.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133911628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23650.11e-104Homeodomain-like transcriptional regulator